Home > Receptors & Transporters > Peptide Receptors > Glucagon and Related Receptors > Exendin-4 (Exenatide) 

Exendin-4 (Exenatide)

Potent GLP-1 receptor agonist

Other names: AC 2993 / Exenatide

Product Code: Asc-214

Purity: >99%

 
Pack Size

 

500µg

1mg

Buy Exendin-4 (Exenatide) from Abcam
Biological Description

High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM).

Useful References

(1992) Exendin-4, a new peptide from Heloderma suspectum venom, potentiates cholecystokinin-induced amylase release from rat pancreatic acini. Regul Pept. 41:149-56 abstract

(1992) Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. Further evidence for an exendin receptor on dispersed acini from guinea pig pancreas. J Biol Chem. 267:7402-5 abstract

(1993) Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor. Diabetes. 42(11):1678-82 abstract

Chemical Information

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Asc-214
  • Desiccate at -20°C
  • MW 4186.61
  • Soluble in water to 10 mg/ml
  • C184H282N50O60S
  • 141758-74-9