GsAF-II Supplier | Abcam Biochemicals® | High Quality Biochemicals
Home > Ion Channels > Sodium > GsAF-II 

GsAF-II

Selective hERG1 channel and voltage-gated Na+ channel blocker

Product Code: Asc-5542

Purity: >98%

 
Pack Size

 

100µg

Buy GsAF-II from Abcam
Biological Description

Selective hERG1 channel (IC50 values are 4.7 and >200 μM for hERG1 and hERG2/3 respectively) and voltage-gated Na+ channel blocker. In the same family as GrTx1 (Asc-5540), GsAF-I (Asc-5541) and GTx1-15 (Asc-5543). Shows similar sodium channel blockade profile as GrTx1; NaV1.1, NaV1.2, NaV1.3, NaV1.4, NaV1.6, NaV1.7.

Useful References

Target promiscuity and heterogeneous effects of tarantula venom peptides affecting Na+ and K+ ion channels. abstract

Characterization of voltage-dependent calcium channel blocking peptides from the venom of the tarantula Grammostola rosea. abstract

Molecular Cloning and Sequence Analysis of the cDNAs Encoding Toxin-Like Peptides from the Venom Glands of Tarantula Grammostola rosea. abstract

Chemical Information

YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW. (Modifications: Disulfide bonds: 2-16, 9-21, 15-25)

Asc-5542
  • Desiccate at -20°C
  • MW 3979.71
  • C176H261N47O45S7