ProTx-II Supplier | Abcam Biochemicals® | High Quality Biochemicals
Home > Ion Channels > Sodium > ProTx-II 

ProTx-II

Potent, selective NaV1 channel blocker

Product Code: Asc-1880

Purity: >98%

 
Pack Size

 

10µg

100µg

Buy ProTx-II from Abcam
Biological Description

Potent, selective NaV1 channel blocker (IC50 values are 0.3 and 30-150 nM for NaV1.7 and other NaV1 subtypes respectively). Acts as a gating modifier similar to ProTX-I (Asc 1863) and shifts the voltage dependence of activation to more depolarized potentials. Selectively blocks the C-fibre compound action potential in vivo.

Useful References

ProTx-II, a selective inhibitor of NaV1.7 sodium channels, blocks action potential propagation in nociceptors. abstract

ProTx-I and ProTx-II: gating modifiers of voltage-gated sodium channels. abstract

Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. abstract

Chemical Information

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW (Modifications: Disulfide bonds: 2-16, 9-21, 15-25)

Asc-1880
  • Desiccate at -20°C
  • MW 3832.60
  • Soluble in water
  • C168H256N46O41S8