Psalmotoxin-1 Supplier | Abcam Biochemicals® | High Quality Biochemicals
Home > Ion Channels > Sodium > Psalmotoxin-1 

Psalmotoxin-1

Potent, selective ASIC1a blocker

Other names: PcTx1

Product Code: Asc-483

Purity: >95%

 
Pack Size

 

20µg

100µg

Buy Psalmotoxin-1 from Abcam
Biological Description

Potent, selective acid sensing (proton gated) ion channel 1a (ASIC1a) blocker. Inhibits cation currents mediated by ASICs (IC50 = 36 pM). Displays highly potent analgesic properties against neuropathic pain.

Useful References

The receptor site of the spider toxin PcTx1 on the proton-gated cation channel ASIC1a. abstract

Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. abstract

A tarantula peptide against pain via ASIC1a channels and opioid mechanisms. abstract

Citations

Acidotoxicity and acid-sensing ion channels contribute to motoneuron degeneration. abstract

Chemical Information

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Modifications: Disulfide bonds: 3-18, 10-23, 17-33)

Asc-483
  • Desiccate at -20°C
  • MW 4689.41
  • Soluble in water
  • C200H312N62O57S6