VSTX3 Supplier | Abcam Biochemicals® | High Quality Biochemicals
Home > Ion Channels > Sodium > VSTX3 

VSTX3

Voltage gated sodium channel blocker

Product Code: Asc-5561

Purity: >98%

 
Pack Size

 

50µg

100µg

Buy VSTX3 from Abcam
Biological Description

Voltage gated sodium channel blocker. Inhibits NaV1.3, NaV1.7 and NaV1.8 channels.

Useful References

Localization of the voltage-sensor toxin receptor on KvAP. abstract

Chemical Information

DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Modifications: Disulfide bonds: 2-17, 9-22, 16-29)

Asc-5561
  • Desiccate at -20°C
  • MW 4171.74
  • C182H261N51O51S6