ω-Agatoxin IVA Ca2+ channel blocker (P and Q type)

Biological Description Synthetic peptide, originally isolated from Agelenopsis aperta spider venom. Selective blocker of Cav2.1 (P/Q type) channels.
Useful References Nishio et al (1993) Synthesis of omega-agatoxin IVA and its related peptides. Biochem Biophys Res Commun. 196:1447-53 abstract Nakanishi et al (1995) Spatial distribution of omega-agatoxin IVA binding sites in mouse brain slices. J Neurosci Res. 41:532-9 abstract
Chemical Information KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA disulfide bridges: 4-20, 12-25, 19-36, 27-34
	Desiccate at -20°C MW 5202.25 Soluble in water C₂₁₇H₃₆₀N₆₈O₆₀S₁₀ 145017-83-0